(data stored in ACNUC7421 zone)

EMBL: BA000007.YAIZ

BA000007.YAIZ        Location/Qualifiers
FT   CDS_pept        459373..459585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiZ"
FT                   /locus_tag="ECs_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33853"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33853"
FT                   /db_xref="InterPro:IPR020490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5H4"
FT                   /protein_id="BAB33853.2"
FT                   /translation="MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGL
FT                   VTWVISFWLAGLIIRRRDEETENAQ"
     atgaatctgc ctgtaaaaat ccgccgtgac tggcactact atgcgttcgc cattggcctt        60
     atattcattc ttaatggcgt ggtggggtta ctgggatttg aagcaaaagg ttggcagacc       120
     tatgccgtcg gtctggtgac gtgggtgatt agtttctggc tggcggggtt gattattcgt       180
     cgtcgcgatg aagaaactga aaacgcccaa taa                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page