(data stored in ACNUC7421 zone)

EMBL: BA000007.YAJD

BA000007.YAJD        Location/Qualifiers
FT   CDS_pept        494861..495208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="ECs_0463"
FT                   /product="HNH nuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33886"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33886"
FT                   /db_xref="GOA:P0AAQ4"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAQ4"
FT                   /protein_id="BAB33886.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
     atggctatca tcccaaaaaa ctatgcgcgg ttagaaagcg gctatcgcga aaaagcatta        60
     aaaatctatc cgtgggtctg cggtcgctgt tcccgcgagt ttgtttattc caacctgcgt       120
     gaacttaccg ttcaccacat tgatcacgac cataccaata acccggaaga tggcagtaac       180
     tgggaattgc tttgtctcta ttgccacgat catgagcatt cgaaatatac cgaagcggat       240
     cagtatggta cgaccgttat cgcaggggaa gatgcgcaga aagatgtcgg tgaagcgaag       300
     tacaacccat tcgctgacct gaaagcgatg atgaacaaga agaagtga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page