(data stored in ACNUC7421 zone)

EMBL: BA000007.YAJQ

BA000007.YAJQ        Location/Qualifiers
FT   CDS_pept        510737..511228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="ECs_0480"
FT                   /product="nucleotide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33903"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33903"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8E9"
FT                   /protein_id="BAB33903.2"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDAS
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIES
FT                   ATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD
FT                   "
     atgccatctt tcgatattgt ctctgaagtt gatcttcagg aagcacgtaa cgcggtcgat        60
     aacgcgagcc gcgaagtgga gtcccgtttt gacttccgta acgttgaagc ctcatttgag       120
     ctgaacgacg ccagcaaaac catcaaagtg ttgagcgagt ccgacttcca ggtcaatcag       180
     ttgctggata ttctgcgtgc caagctgctg aagcgcggca ttgaaggcag ttcactggat       240
     gtaccggaaa atatcgttca tagcggtaaa acctggtttg tggaagcgaa actgaaacag       300
     ggcattgaga gcgccactca gaaaaaaatc gtcaagatga tcaaagacag caaactgaaa       360
     gtgcaggcgc aaattcaggg cgatgagatc cgtgtgacgg gcaaatctcg tgatgattta       420
     caggctgtca tggcgatggt gcgcggtggc gatctcggtc agccgttcca gttcaaaaac       480
     ttccgcgatt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page