(data stored in ACNUC7421 zone)

EMBL: BA000007.YBAA

BA000007.YBAA        Location/Qualifiers
FT   CDS_pept        542738..543091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="ECs_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33932"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33932"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAQ8"
FT                   /protein_id="BAB33932.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
     atgaagtatg ttgatggttt tgtggttgcc gttcctgccg ataaaaagga tgcctatcgg        60
     gaaatggccg ctaaggccgc gccattgttt aaagagtttg gcgcgcttcg tattgtcgaa       120
     tgctgggcca gcgatgtacc ggatggcaaa gtgaccgatt ttcgtatggc ggtgaaagcg       180
     gaagagaatg aagaggttgt ctttagctgg attgaatacc cttcaaaaga ggtccgcgac       240
     gcagctaatc aaaagatgat gtcggaccca cggatgaaag agttcggcga gtccatgccg       300
     tttgacggca agcgaatgat ctatggcgga ttcgagtcaa tcatcgacga atag             354
//

If you have problems or comments...

PBIL Back to PBIL home page