(data stored in ACNUC7421 zone)

EMBL: BA000007.YBAB

BA000007.YBAB        Location/Qualifiers
FT   CDS_pept        559972..560301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="ECs_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33947"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33947"
FT                   /db_xref="GOA:P0A8B7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8B7"
FT                   /protein_id="BAB33947.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
     atgtttggta aaggcggtct gggtaacctg atgaagcaag cccagcagat gcaagaaaaa        60
     atgcagaaaa tgcaggaaga gatcgcgcag ctggaagtta ccggcgaatc tggcgcaggt       120
     ctggtaaaag tgaccatcaa cggtgcacat aactgccgtc gcgtagagat cgacccgagc       180
     ctgctggaag acgacaaaga gatgctggaa gacctggtgg ctgcagcatt caacgacgca       240
     gcacgtcgta ttgaagaaac gcagaaagaa aaaatggctt ctgtatcctc cggaatgcag       300
     ctgccgcctg gctttaagat gccgttctga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page