(data stored in ACNUC7421 zone)

EMBL: BA000007.YBAE

BA000007.YBAE        Location/Qualifiers
FT   CDS_pept        complement(531677..533377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="ECs_0499"
FT                   /product="ABC transporter periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33922"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33922"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE51"
FT                   /protein_id="BAB33922.1"
FT                   /translation="MRLLNRLNQYQRLWQPSAGKPQTVTVSELAERCFCSERHVRTLLR
FT                   QAQEAGWLEWQAQSGRGKRGQLRFLVTPESLRNAMMEKALETGKQQDVLELAQLAPGEL
FT                   RTLLQPFMGGQWQNDTPTLRIPYYRPLEPLQPGFLPGRAEQHLAGQIFSGLTRFDNNTQ
FT                   RPIGDLAHHWETSADGLRWDFYLRSTLHWHNGDAVKASHLHQRLLMLLQLPALDQLFIS
FT                   VKRIEVTHPQCLTFFLHRPDYWLAHRLASYCSHLAHPQFPLIGTGPFRLTQFTAELVRL
FT                   ESHDYYHLRHPLLKAVEYWITPPLFEKDLGTSCRHPVQITIGKPEELQRVSQVSSGISL
FT                   GFCYLTLRKSPRLSLWQARKVISIIHQSGLLQTLEVGENLITASHALLPGWTIPHWQVP
FT                   DEVKLPKTLTLVYHLPIELHTMAERLQATLAAEGCELTIIFHNAKNWDDTTLLAHADLM
FT                   MGDRLIGEAPEYTLEQWLRCDPLWPHVFDAPAYAHLQSTLDAVQVMPDEENRFNALKAV
FT                   FSQLMTDATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFTEAWLPAPSQ"
     atgcgactgc tcaaccgcct taaccagtat caacgtctgt ggcaaccttc cgccggaaag        60
     ccgcaaaccg tcaccgtcag cgaactggcc gaacgctgtt tttgcagcga acgccatgtt       120
     cgtacgctgt tgcgtcaggc acaggaagcg ggatggctgg agtggcaggc gcagtcagga       180
     cgcggaaagc gcggacaatt acgctttctg gtcacgccag aatcgctacg caatgcgatg       240
     atggaaaagg cactggaaac cggaaagcag caagatgtgc tggagctggc gcaactggcc       300
     ccaggtgagc tgcgcactct gttacagccg tttatgggcg gacaatggca aaacgataca       360
     cccacgttgc gtattcccta ctatcgcccg ctcgaaccgc tacaaccggg ctttttgccc       420
     ggccgtgccg agcagcatct cgccggacag atattttccg gcctgacccg cttcgataat       480
     aatacccagc gcccgattgg cgatttagcg catcactggg aaacctctgc tgacgggtta       540
     cgctgggact tttatcttcg ttcaacccta cactggcata acggcgatgc agtaaaagcc       600
     tcacacttac accagcgatt attgatgctg ttacaactgc cagcactgga tcaattattt       660
     attagcgtga agcgtattga ggtcacccat ccgcagtgtc tgaccttctt tttacatcgc       720
     cccgattact ggcttgcgca ccggctggcg agctattgca gccatctggc gcatccgcaa       780
     ttcccactga ttggcacggg tccttttcgc ttaacacaat tcacagctga actggtgcgc       840
     ctggaaagcc atgattatta ccatttacgt catccgctgc ttaaagcggt tgagtactgg       900
     ataactccgc cgcttttcga aaaagatttg ggaaccagtt gtcggcatcc cgtgcaaatc       960
     accatcggca aaccggagga gctgcaacgg gtcagccagg tcagtagtgg catcagttta      1020
     ggtttttgct atttaacgtt gcgcaaaagt ccccgactct ccctctggca ggcgcgaaaa      1080
     gtgatctcca ttattcatca atccggttta ttacaaacgt tagaagtcgg agaaaacctg      1140
     atcaccgcca gtcatgcatt actgccaggc tggactattc cgcattggca agtaccggat      1200
     gaagtcaaac taccgaaaac cttgacgctg gtttatcacc tcccgataga acttcatacc      1260
     atggcagaac gcctacaggc gacactggca gcggaaggct gtgaactcac aattattttt      1320
     cataacgcaa aaaactggga cgacacgacc ctactggcac acgcagacct catgatgggc      1380
     gacagattaa ttggcgaagc accggaatat actctggagc aatggctgcg ctgcgatccg      1440
     ctgtggccac atgttttcga cgctccagca tacgcacatc tacaatcgac actggacgcg      1500
     gtgcaagtaa tgcctgatga ggaaaaccga tttaatgccc tgaaagcggt ttttagccag      1560
     ttaatgacag atgcgacgct gacgccgctg ttcaactatc actatcgcat tagtgcccct      1620
     cccggcgtga acggtgtgcg actgacaccg cgcggctggt ttgaatttac cgaagcctgg      1680
     cttcccgcgc cgtcgcaatg a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page