(data stored in ACNUC7421 zone)

EMBL: BA000007.YBAM

BA000007.YBAM        Location/Qualifiers
FT   CDS_pept        complement(556003..556167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="ECs_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33942"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33942"
FT                   /db_xref="InterPro:IPR019630"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD52"
FT                   /protein_id="BAB33942.1"
FT                   /translation="MSLENAPDDVKLAVDLIVLLEENQIPARTVLRALDIVKRDYEKKL
FT                   QSDEASQSE"
     atgtcactgg aaaatgcccc tgacgatgtc aaactggctg tcgatttgat tgtgctgctg        60
     gaagaaaatc agatcccagc ccgcaccgtg ctgcgcgcgc tggatattgt aaagcgtgat       120
     tatgaaaaga agttacagag cgatgaggct tcacaaagcg agtaa                       165
//

If you have problems or comments...

PBIL Back to PBIL home page