(data stored in ACNUC7421 zone)

EMBL: BA000007.YBAN

BA000007.YBAN        Location/Qualifiers
FT   CDS_pept        556778..557155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="ECs_0521"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33944"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33944"
FT                   /db_xref="GOA:P0AAR6"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAR6"
FT                   /protein_id="BAB33944.1"
FT                   /translation="MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGSYLRFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIMLLVI
FT                   LACLLFYMWRIPVIDEKQEKH"
     atgcaacgaa tcattttaat catcattggc tggctggcgg tagtgctggg cacgctgggc        60
     gtggtattac cggtattacc gacgacgccg tttatcctgc tggcggcctg gtgctttgcc       120
     cgttcttccc cgcgctttca cgcctggttg ctgtaccgct catggtttgg cagctatcta       180
     cgtttctggc agaaacatca tgcgatgccg cgcggcgtca aaccgcgggc gattttgctt       240
     attttgctca cgtttgccat ttctctgtgg ttcgtccaga tgccatgggt gcgcatcatg       300
     ttgctggtaa ttctcgcctg tttgcttttc tatatgtggc gaattccggt gattgatgaa       360
     aagcaagaaa agcactga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page