(data stored in ACNUC7421 zone)

EMBL: BA000007.YBAT

BA000007.YBAT        Location/Qualifiers
FT   CDS_pept        578266..579558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaT"
FT                   /locus_tag="ECs_0539"
FT                   /product="amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33962"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33962"
FT                   /db_xref="GOA:Q8XD21"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD21"
FT                   /protein_id="BAB33962.1"
FT                   /translation="MMNTEGNNGNKPLGLWNVVSIGIGAMVGAGIFALLGQAALLMEAS
FT                   TWVAFAFGGIVAMFSGYAYARLGASYPSNGGIIDFFRRGLGNGVFSLALSLLYLLTLAV
FT                   SIAMVARAFGAYAVQFLHEGSQEEHLILLYALGIIAVMTLFNSLSNHAVGRLEVILVGI
FT                   KMMILLLLIIAGVWSLQPAHISVSAPPSSGAFFSCIGITFLAYAGFGMMANAADKVKDP
FT                   QVIMPRAFLVAIGVTTLLYISLALVLLSDVSALELEKYADTAVAQAASPLLGHVGYVIV
FT                   VIGALLATASAINANLFAVFNIMDNMGSERELPKRMNKSLWRQSTWGNIIVVVLIMLMT
FT                   AALNLGSLASVASATFLICYLAVFVVAIRLRHDIHASLPILIVGTLVMLLVIVGFIYSL
FT                   WSQGSRALIWIIGAILLSLIVAMVMKRNKTV"
     atgatgaaca cggaaggtaa taacggtaac aaacccctcg gtctatggaa cgtcgtttcc        60
     atcggcattg gggcaatggt gggggcgggg atcttcgcgc tgctggggca ggctgcgttg       120
     ctaatggaag cctcgacctg ggtcgccttt gcttttggcg gtattgtggc gatgttttcc       180
     ggttatgcct atgcgcgtct gggggcgagc tatcccagca atggcggcat tatcgacttc       240
     tttcgtcgcg gattaggcaa cggcgtcttt tcgctggcgc tctcgttact gtacctgttg       300
     acgctggcgg tgagcatcgc catggtcgcc cgtgcttttg gcgcttatgc cgtgcagttt       360
     ttgcatgaag gcagccagga ggagcacctt attttgctct acgcgttggg gatcattgcg       420
     gtgatgacgc ttttcaactc cttaagcaac catgcggtag ggcggctgga ggtgatcctc       480
     gtcggcatta aaatgatgat cctgttattg ctgattattg ccggtgtctg gtcgctgcaa       540
     ccggcgcata tttccgtctc tgcgcccccc agctccggtg cgttcttctc ctgtatcggg       600
     ataaccttcc ttgcctatgc gggctttggc atgatggcga acgcggcgga taaagtgaaa       660
     gatccgcagg tcattatgcc acgggcgttt ctggtggcaa ttggcgttac cacgttgctt       720
     tatatctcgc tggcgctggt tttgcttagc gatgtatcgg cattagagtt agaaaaatat       780
     gccgataccg ccgtagcgca ggctgcttct ccgctgctcg ggcatgtggg ttatgtgatc       840
     gtcgtcatcg gcgctttact ggcgacggct tcagccatca acgcgaacct gttcgccgtg       900
     tttaacatca tggacaacat gggcagcgaa cgcgaactgc cgaagcgaat gaataaatcc       960
     ctgtggcggc agagtacctg gggcaacatc attgtcgtgg tgttgattat gctgatgacg      1020
     gcggcactaa atttaggctc actcgccagc gttgccagcg ccaccttttt gatttgctat      1080
     ctggcggtgt ttgtggtggc gatccgcctg cgtcatgata ttcacgcctc gttgccgatt      1140
     cttatcgtag gtacgttggt gatgttgttg gtgatcgttg gctttatcta cagcctgtgg      1200
     tcccagggca gccgtgcgtt gatatggatt attggtgcaa tcttactcag ccttattgtg      1260
     gcaatggtca tgaagcgcaa taaaaccgta taa                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page