(data stored in ACNUC7421 zone)

EMBL: BA000007.YBAV

BA000007.YBAV        Location/Qualifiers
FT   CDS_pept        529990..530361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="ECs_0496"
FT                   /product="competence-suppressing periplasmic
FT                   helix-hairpin-helix DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33919"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33919"
FT                   /db_xref="GOA:Q8XE54"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE54"
FT                   /protein_id="BAB33919.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAASVAKPTAVETKAEAPAAQ
FT                   NKAAVPAKASDEEGSRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
     atgaaacacg gaattaaagc actgctcatt accctgtccc tggcctgtgc cggaatgtct        60
     catagcgcgc tggcggcagc ttctgtggcg aaaccgacgg cggtagaaac caaagcggaa       120
     gctcctgcag cacaaaataa agcagcagta ccggcgaaag ccagtgacga agaaggctcc       180
     cgggtcagca ttaataatgc cagcgcggaa gagctagccc gcgcgatgaa tggcgttggc       240
     ctgaagaaag cgcaagcgat tgtcagttat cgcgaagagt acggtccgtt taaaacggtg       300
     gaggatctaa agcaggtgcc ggggatgggc aattcgctgg tggaacgtaa tctggcggta       360
     ttaaccctgt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page