(data stored in ACNUC7421 zone)

EMBL: BA000007.YBBJ

BA000007.YBBJ        Location/Qualifiers
FT   CDS_pept        complement(608199..608657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="ECs_0551"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33974"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33974"
FT                   /db_xref="GOA:Q8XD05"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD05"
FT                   /protein_id="BAB33974.2"
FT                   /translation="MMELIVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLV
FT                   VWLVPLGWEWQGVMFAVLTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLE
FT                   SPLVNGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLIIRAVIA"
     atgatggagt taatagtcgt tcatccacat attttctggc tcagtctcgg cggtttgctg        60
     ctggcagccg agatgctggg cggaaatggt tatttgttgt ggagtggcgt ggcagcagtg       120
     attactggcc tggtggtctg gctggtgccg ctgggttggg agtggcaagg ggtgatgttt       180
     gccgtcctga cgctgctcgc cgcctggctg tggtggaaat ggttgtcgcg gcgggtgcgc       240
     gaacaaaagc acagcgacag tcatttaaac cagcgcgggc agcagctgat tggccgacgt       300
     tttgtgctgg aatctccgct ggtcaacggg cgcggtcata tgcgcgtcgg tgacagttca       360
     tggcctgtca gcgccagcga ggatctcggc gcaggtacgc atgttgaagt cattgcgata       420
     gaagggataa cgctgatcat ccgtgcggtc atcgcctga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page