(data stored in ACNUC7421 zone)

EMBL: BA000007.YBCF

BA000007.YBCF        Location/Qualifiers
FT   CDS_pept        642948..643841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="ECs_0583"
FT                   /product="carbonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34006"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34006"
FT                   /db_xref="GOA:Q8XCV5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XCV5"
FT                   /protein_id="BAB34006.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKEVEPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTV
FT                   RTRIEVSPDDPAFLQPEKFIGPVYQPEEQEALEAAYGWQMKRDGKYLRRVVASPQPRKI
FT                   LDSEAIELLLKEGHVVICSGGGGVPVTDDGAGSEAVIDKDLAAALLAEQINADGLVILT
FT                   DADAVYENWGMPQQRAIRHATPDELAPFAKADGSMGPKVTAVSGYVRSRGKPAWIGALS
FT                   RIEETLAGEAGTCISL"
     atgaaaacac tggttgtagc tcttgggggc aacgccttac tccagcgcgg tgaggcgctg        60
     acggcagaaa atcaatatcg caatatcgcc agtgctgtac ccgcgctggc gcgcctggcc       120
     cgttcttatc ggctggcgat tgttcacggc aacgggccgc aggtggggct gctggcattg       180
     cagaatctgg cgtggaaaga ggtagaaccg tatccgctgg atgtgctggt ggcagaaagt       240
     caggggatga ttggctatat gctggcgcag agtttgagcg cacagccgca gatgccgcct       300
     gtcacgacgg tgcggacgcg cattgaagtt tcgcctgatg atccggcgtt tttgcagcca       360
     gagaaattta ttggtccggt ttatcagcca gaagaacaag aggcactgga agcggcttac       420
     ggctggcaga tgaaacgtga tggtaaatat ttgcgccggg tggtggcgtc tccgcaaccg       480
     cgtaaaattc tcgacagcga agccatcgag ttgttgctca aagaggggca tgtggtgatt       540
     tgcagtggcg gcggcggtgt gcctgtgacg gatgacggag cagggagtga agcagtgatt       600
     gataaagatc tcgccgctgc gttgctcgcc gagcaaatta acgccgatgg actggtgatc       660
     ctcaccgatg ctgatgcggt atatgaaaac tggggaatgc cgcagcaacg tgccattcgc       720
     catgccacac cggatgagtt agcgccattt gccaaagccg atggttcgat ggggccgaag       780
     gtaacggcgg tgagtggtta tgtcagaagc cgtggtaaac ccgcgtggat tggggcgtta       840
     tcgcgaattg aagagacgct ggcgggcgaa gcggggacct gtatttcgct gtag             894
//

If you have problems or comments...

PBIL Back to PBIL home page