(data stored in ACNUC7421 zone)

EMBL: BA000007.YBCH

BA000007.YBCH        Location/Qualifiers
FT   CDS_pept        complement(658249..659139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="ECs_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34022"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34022"
FT                   /db_xref="InterPro:IPR027849"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X566"
FT                   /protein_id="BAB34022.1"
FT                   /translation="MRKFIFVLLTLLLVSPFSFAMKGIIWQPQNRDSQVTDTQWQGLMS
FT                   QLRLQGFDTLVLQWTRYGDAFTQPEQRALLFKRAAAAQQAGLKLIVGLNADPEFFMHQK
FT                   QSSAALESYLNRLLAADLQQARLWSAVPGVTPDGWYFSAEIDDLNWRSEAARQPLLTWL
FT                   NNAQRLISDVSAKPVYISSFFAGNMSPDGYRQLLEHVKATGVNVWVQDGSGVDKLTAEQ
FT                   RERYLQASADCQSSAPASGIVYELFVAGKGKTFTAKPKPDAEIASLLAKRSSCGKDTLY
FT                   FSLRYLPVAHGILEY"
     atgcgtaagt tcattttcgt attgctgaca ctgcttttgg tcagcccttt ttcctttgcg        60
     atgaaaggta ttatctggca accacaaaac cgtgatagtc aggttaccga tacccagtgg       120
     caggggctga tgagtcagtt acgtttgcaa ggcttcgata ccctggtttt gcaatggacc       180
     cgttacggcg atgcattcac ccagccagaa cagcgcgcgt tattgtttaa gcgggccgca       240
     gctgcgcaac aggctggcct gaagctgatt gtcgggctga acgccgatcc ggaatttttt       300
     atgcaccaga aacagtcatc cgcggcgctg gaaagctatc ttaatcgcct gctggctgcc       360
     gatctccagc aagccagatt atggagtgcc gtacctggcg taacgccgga tggctggtac       420
     ttcagcgctg aaattgacga cctgaactgg cgcagcgaag ccgcccgtca gcctttgcta       480
     acatggttaa acaacgcgca gcggctgatt agcgatgttt cagcaaaacc ggtttatatc       540
     agtagttttt tcgccggaaa catgtcgcca gatggctatc gccaactgct ggaacacgtt       600
     aaagcaaccg gcgttaatgt ctgggtacag gatggcagcg gcgtggataa acttaccgct       660
     gaacagcgtg aacgttatct acaggccagc gccgattgcc aaagctccgc cccagcaagc       720
     ggcattgttt atgaactgtt tgtcgccggc aaaggcaaaa cctttacagc gaaaccgaaa       780
     ccggacgcag aaattgcctc gctgttagcg aaacgttcct cttgcggtaa agacactctc       840
     tatttctctc tgcgctattt gcccgtcgcg cacggcattc tcgagtatta a                891
//

If you have problems or comments...

PBIL Back to PBIL home page