(data stored in ACNUC7421 zone)

EMBL: BA000007.YBCJ

BA000007.YBCJ        Location/Qualifiers
FT   CDS_pept        complement(649114..649326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcJ"
FT                   /locus_tag="ECs_0590"
FT                   /product="ribosome-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34013"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34013"
FT                   /db_xref="GOA:Q8XCT7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCT7"
FT                   /protein_id="BAB34013.2"
FT                   /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAV
FT                   ETRKRCKIVAGQTVSFAGHSVQVVA"
     atggcgacat tttctttagg taaacatccg cacgttgagc tgtgcgactt gctgaaactg        60
     gaaggctgga gcgaaagcgg cgcgcaggcg aaaatcgcga ttgccgaagg ccaggtgaaa       120
     gtcgacggcg cggttgaaac gcgcaaacgc tgcaaaatcg tcgccgggca gacagtgagt       180
     tttgcaggtc acagcgtaca ggttgttgcc tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page