(data stored in ACNUC7421 zone)

EMBL: BA000007.YBDD

BA000007.YBDD        Location/Qualifiers
FT   CDS_pept        713652..713849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdD"
FT                   /locus_tag="ECs_5382"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2Z5XGZ6"
FT                   /protein_id="BBE29398.1"
FT                   /translation="MFDSLAKAGKYLGQAAKLMIGMPDYDNYVEHMRVNHPDQTPMTYE
FT                   EFFRERQDARYGGKGGARCC"
     atgtttgatt cactggcaaa agccggaaaa tatttaggtc aggcggcgaa gctgatgatt        60
     ggtatgcctg attacgacaa ctatgtcgaa catatgcggg ttaaccatcc cgatcaaacg       120
     ccgatgacct acgaagagtt tttccgtgag cggcaggacg cgcgctacgg tggaaaaggc       180
     ggcgcgcgct gctgctaa                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page