(data stored in ACNUC7421 zone)

EMBL: BA000007.YBDM

BA000007.YBDM        Location/Qualifiers
FT   CDS_pept        complement(716217..716846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="ECs_0640"
FT                   /product="chromosome partitioning protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34063"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34063"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBU4"
FT                   /protein_id="BAB34063.1"
FT                   /translation="MGDTMQQRLTQDLTQFLASLPEDDRINAINEIRMAIHQVSPFREE
FT                   PVDCVLWVKNSQLMPNDYNPNNVAPPEKKLLKKSIEIDGFTQPIVVTHTDKNALEIVDG
FT                   FHRHEIGKGSSSLKLRLKGYLPVTCLEGTRNQRIAATIRHNRARGRHQITAMSEIVREL
FT                   SQLGWDDNKIGKELGMDSDEVLRLKQINGLQELFADRQYSRAWTVK"
     atgggggata ctatgcaaca acgattaacg caggatttaa cgcaatttct cgccagcttg        60
     ccggaagatg atcgcatcaa cgcgattaat gaaatccgca tggcgatcca tcaggttagc       120
     ccctttcgtg aagagccagt ggattgcgtt ctgtgggtta aaaacagcca acttatgcct       180
     aatgattaca acccaaacaa cgtggcacca cccgaaaaaa aactgctgaa aaaatccatt       240
     gaaatagatg gttttaccca acccattgtg gtcacgcata cggataaaaa tgccctggaa       300
     atcgtggatg gttttcaccg ccatgaaatt ggtaaaggct catcatcatt aaaattacgc       360
     ttaaaaggtt atttgccggt gacctgtctg gaaggtacgc gtaatcaacg catcgccgcg       420
     actattcgtc ataatcgcgc tcgtggacgc catcaaatca ccgccatgtc ggaaatcgtc       480
     cgtgaactca gtcagttggg atgggacgat aataaaattg gcaaagagct gggaatggac       540
     agcgacgaag tgctgcgcct gaagcaaatt aacggtctgc aagagctgtt tgccgaccgt       600
     caatattccc gcgcctggac tgtcaaataa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page