(data stored in ACNUC7421 zone)

EMBL: BA000007.YBDZ

BA000007.YBDZ        Location/Qualifiers
FT   CDS_pept        695599..695817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdZ"
FT                   /locus_tag="ECs_5381"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X498"
FT                   /protein_id="BBE29397.1"
FT                   /translation="MAFSNPFDDPQGVFYILRNAQGQFSLWPQQCALPAGWDIVCQPQS
FT                   QESCQQWLEVHWRTLTPANFTQLQEAQ"
     atggcattca gtaatccctt cgatgatcca cagggagtgt tttacatttt gcgcaatgcg        60
     caggggcaat tcagtctgtg gccgcaacaa tgcgccttac cggcaggctg ggacattgtg       120
     tgtcagccgc agtcacaaga gtcctgccag cagtggctgg aagtccactg gcgtactctg       180
     acaccggcga atttcaccca gttgcaggag gcacaatga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page