(data stored in ACNUC7421 zone)

EMBL: BA000007.YBER

BA000007.YBER        Location/Qualifiers
FT   CDS_pept        758072..758779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeR"
FT                   /locus_tag="ECs_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34106"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34106"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X522"
FT                   /protein_id="BAB34106.1"
FT                   /translation="MDMESQKILFALSTPMEIRNECCLPSHSSPKMYLGTRFFDLSSSW
FT                   GIDDRDDLLRTIHRMIDNGHAARLAGFYHRWFRYSPCEWRDYLAELNEQGQAYAQFVAS
FT                   TAECCGEGGIKAWDYVRMGFLSRMGVLNNWLSEEESLWIQSRIHLRALRYYSNWRQYFA
FT                   GYTFGRQYWQSPEDDNLPLLREFLARKEYDDSGNDMFYQLFASDDAYYATLPWQPLADY
FT                   PTCPETLKDMSDL"
     atggacatgg agtcgcaaaa aatattgttt gcactttcca ctccgatgga aatacgcaat        60
     gaatgctgtt taccttcgca ttcatcaccc aaaatgtatt taggtacacg cttttttgac       120
     ctttcttcct cctggggaat tgatgaccgt gatgacctgc tgcgcacaat tcaccgaatg       180
     atcgataacg gtcatgccgc gcggttggca gggttttatc accgctggtt tcgttattct       240
     ccatgtgaat ggcgtgacta tcttgctgaa ttaaatgagc aaggtcaggc ttatgcgcaa       300
     tttgtcgcca gcacagccga atgctgtggt gagggaggaa ttaaagcatg ggattatgtc       360
     cggatgggtt ttttaagtcg aatgggcgta cttaataact ggttgagtga agaagaaagt       420
     ctatggatcc agtcgcgtat tcatctacgg gctctacgtt attatagtaa ctggcggcaa       480
     tactttgccg gttatacctt tggtcggcaa tattggcagt ctcccgaaga tgataatctg       540
     cctttattac gtgaattctt agcgcgtaaa gaatacgacg attccggcaa tgatatgttt       600
     tatcaattat ttgccagtga cgatgcatat tacgcgacct taccctggca accactggct       660
     gactacccca catgcccgga aacgcttaag gatatgagcg acctatga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page