(data stored in ACNUC7421 zone)

EMBL: BA000007.YBET

BA000007.YBET        Location/Qualifiers
FT   CDS_pept        complement(760213..760767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeT"
FT                   /locus_tag="ECs_0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34108"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34108"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBM0"
FT                   /protein_id="BAB34108.1"
FT                   /translation="MNKKLMYIFTIFIVAAITCISQPKKTTLRDKAMVNYAFDYLSSPG
FT                   SLPFTTAATELSAIHGHSTSQYRLGEFYLHGSDGKPLDYTQARYWYEQSAEQENPRAQS
FT                   KLGWIYLKGLGVKPDTRKAILWYKEAAEQGYAHAQYTLGLIYRNGSGINVNHYESQKWL
FT                   KLAAKQHYKNAERLLAGLPAH"
     atgaataaaa aattaatgta tatattcaca atttttatag ttgcagcaat tacctgtatt        60
     agccaaccca agaaaacgac gttgcgtgat aaagccatgg tgaattatgc ctttgattat       120
     ttaagctcac cgggcagtct tccattcacc acggcagcca cggagctttc cgcgattcat       180
     ggtcactcaa cgtcgcaata tcgccttgga gaattttatc ttcatggtag cgacggtaaa       240
     ccactggatt atacacaggc gagatactgg tatgagcaat cagcggaaca ggaaaatcca       300
     cgcgcgcaaa gtaaactggg gtggatctac ctcaaaggtc tgggggtcaa acccgacacc       360
     cgtaaagcaa ttctctggta taaggaagca gctgaacaag ggtatgctca tgctcaatat       420
     actttaggtt tgatctacag aaatggctca ggtattaatg ttaaccatta tgaatctcaa       480
     aaatggttaa aactggccgc caaacaacat tacaaaaatg cggaaagatt acttgccggg       540
     cttcccgcac attaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page