(data stored in ACNUC7421 zone)

EMBL: BA000007.YBEU

BA000007.YBEU        Location/Qualifiers
FT   CDS_pept        760869..761576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeU"
FT                   /locus_tag="ECs_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34109"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34109"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X521"
FT                   /protein_id="BAB34109.1"
FT                   /translation="MNKEEQYLLFALSAPMEILNQGCKPAHDSPKMYTGIKEFDLSSSW
FT                   GINNRDDLIQTIYQMTDDGHANDLAGLYLTWHRSSPEEWKALIAGGSERGLIYTQFVAQ
FT                   TAMCCGEGGIKAWDYVRMGFLSRVGVLNKWLTEDESLWLQSRVYERAHHYYHSWMHYFS
FT                   AYSLGRLYWQSSQCEDNASLREALTLYKYDSAGSRMFEELAAGSDRFYATLPWQPLTVQ
FT                   PECPVTLKDVSDL"
     atgaataagg aagaacaata tcttcttttt gcgctttctg cgcccatgga aatacttaat        60
     cagggttgca aacccgcgca tgactcgcca aaaatgtata ccgggataaa agaattcgat       120
     ctctcatcat cctggggaat aaataatcgt gatgatttaa ttcagactat ttatcagatg       180
     actgatgatg gtcatgccaa tgatttagct ggcttatatc tgacatggca tcgctcttcc       240
     cctgaagagt ggaaagcatt aattgctggt ggctcggaga gagggttgat ttatacccaa       300
     ttcgttgccc aaaccgctat gtgttgtggg gaagggggaa tcaaagcttg ggattatgtt       360
     cgaatggggt ttctgtcacg ggtcggtgtg ctcaacaagt ggctgacgga agacgagagt       420
     ttatggctgc aatcgcgcgt ctatgaacga gctcaccatt actatcacag ctggatgcac       480
     tatttttccg cctattcact agggcgtctc tactggcaat cttctcaatg cgaagacaac       540
     gcttcgctac gcgaggcgct aaccctgtac aaatacgata gcgccgggag tcggatgttc       600
     gaagagctgg ctgcgggaag cgatcgtttc tatgccacgc ttccctggca gccattaact       660
     gtccagcctg aatgcccggt aacgcttaag gatgtgagcg acctatga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page