(data stored in ACNUC7421 zone)

EMBL: BA000007.YBFE

BA000007.YBFE        Location/Qualifiers
FT   CDS_pept        complement(791630..791992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfE"
FT                   /locus_tag="ECs_0716"
FT                   /product="LexA-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34139"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34139"
FT                   /db_xref="GOA:P0AAU8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAU8"
FT                   /protein_id="BAB34139.1"
FT                   /translation="MYYGALSIRAEAWLIVSPEVTKIMAKEQTDRTTLDLFAHERRPGR
FT                   PKTNPLSRDEQLRINKRNQLKRDKVRGLKRVELKLNAEAVEALNELAESRNMSRSELIE
FT                   EMLMQQLAALRSQGIV"
     atgtattatg gcgcgctatc catccgggca gaggcctggc tgattgtttc ccccgaagtc        60
     accaagatca tggccaaaga acaaacggac cgtacgacat tagatctgtt cgcgcacgag       120
     cgtcgaccgg gacgaccgaa aacaaatccg ctttcgcgcg atgaacagct gcgtattaat       180
     aaacgcaacc aactaaaacg cgacaaagta cgtggcctaa agcgtgtcga actgaagctg       240
     aacgcggaag ctgtcgaggc gctgaacgag ctggcggaat cgcgcaatat gagccgtagc       300
     gaactgatcg aagagatgtt aatgcagcaa ctggcggcgc tgcgtagtca gggcatcgtt       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page