(data stored in ACNUC7421 zone)

EMBL: BA000007.YDBD

BA000007.YDBD        Location/Qualifiers
FT   CDS_pept        468385..470664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbD"
FT                   /locus_tag="ECs_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33865"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33865"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024497"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEA4"
FT                   /protein_id="BAB33865.2"
FT                   /translation="MNRINILVICMVLFFMTGNACATEWISSEDLITSDFHLMTADERN
FT                   VVKAATDDSMEAAYMLKDNIRWYYHNGDLSLPANFSNKNKLVVNGNLTISGDYDDYLSG
FT                   NGHLIVLGNVIVDNFINHDFAYVKGQMTAKGLVYADYNDHNFEVMKGISARGIIVSDKA
FT                   TQFEVIKAEFYINEDGSGEGYNWDENIQKAYSLVTADLYDHTEIETDNISNAYPDYDSV
FT                   ADNIVQGLPLFRDKAAPEINEKLKWIETGKLDNFPANKIKHQDPLVARFLTHTESLSPA
FT                   VMLQLLQHPDDQTRESMAQSWPAQQMHWLTDELIKDEAVARGLVKNSNISADVNKKLMS
FT                   VPVESVQLEQARQDNLSPDIVASLSHSPFLSVRKTLLSHYDYAWLVPTAVADELINNED
FT                   PELRERITGADLTAQQAVMLSKDKSLKVREALARTLTELKITQLSATLRTEDIERIAEQ
FT                   MYLDNKENKNIVKVLLIALPEMCQLSLAKEDVHNLREGARYLTSKDVISYLLTQHDVPT
FT                   VWDELARDKLLPLEYKKQLWQRTLNLMMSKRQEDQEQAYEVQLALIDNGVVDEEMLNNA
FT                   IDLLVDLPAEYRYRMRNQLFDNKELPSGIINKLDQQYRFNSDWALAVVSMKNSTRRQSE
FT                   RGLHRWNHEDSDIFAELATIKDKSDDEWWRALLQSRNDHLRQTALRNAHTPASLLTTLT
FT                   ESQDRSLAINNPQLAADVKTVWLKEDPSLLLFVDKPDLSQLRDLVKTGATRKIRNEARH
FT                   RLEEKQ"
     atgaatagaa ttaatatatt ggtcatctgt atggtcttat tttttatgac tggcaatgca        60
     tgtgccacag agtggatcag tagcgaggac cttatcacct ctgactttca tcttatgacg       120
     gcagatgagc gcaacgtggt taaagcggca accgacgata gtatggaagc tgcttatatg       180
     ctaaaagata atatccgctg gtattatcat aatggtgacc tatcattacc cgctaacttc       240
     agcaataaaa ataaactggt ggtgaacggt aatttaacga tttccggcga ttatgatgat       300
     tatctgtcag gtaatggtca tctgattgta ttaggtaatg ttattgtcga taactttatt       360
     aatcatgatt tcgcgtatgt caaaggacag atgacagcga aaggtttagt ttatgctgat       420
     tacaatgatc ataactttga agtgatgaag ggaattagtg cgcgaggcat tattgtttcc       480
     gataaagcaa cgcaatttga agtcattaaa gctgaatttt atatcaatga agatggaagt       540
     ggtgaaggat ataactggga tgagaatatt caaaaagcct attcactggt gactgccgat       600
     ctttatgatc acactgaaat cgaaaccgat aacatttcca atgcgtatcc tgactatgat       660
     agcgtcgcag acaacatcgt tcagggttta ccgctttttc gagataaagc cgctcctgaa       720
     attaatgaga aattaaaatg gattgaaacg gggaaactcg ataatttccc agcgaataaa       780
     ataaagcatc aagatccact ggtggcacgt tttctgactc atacagagag tttatcaccc       840
     gccgttatgc tgcaactgtt acagcacccc gatgaccaga cgcgtgaatc gatggcgcag       900
     tcctggcccg ctcaacagat gcattggctt accgatgaat taattaaaga tgaggctgtt       960
     gccagagggc tggttaaaaa cagtaatatt tccgccgatg tgaataaaaa attaatgtct      1020
     gtacccgtcg agagcgtaca gctggagcag gccagacagg ataatctttc tccagatatt      1080
     gttgcgtcgt taagtcatag cccctttctc agtgtacgca agacattact cagccattac      1140
     gattacgcct ggctggttcc gactgcagtg gccgatgagt tgataaataa cgaagacccg      1200
     gagttacgtg aaagaattac cggagcagat ttaaccgcac aacaagcagt gatgttgagt      1260
     aaagataaat cactgaaagt tcgtgaagca ttagcccgga cgcttactga attaaaaatt      1320
     acccaactgt cagcaaccct gcgtacagag gatattgaac gtatcgcaga acaaatgtat      1380
     ctggataata aagaaaataa aaatatcgta aaggtgttat tgatagcgtt gccggagatg      1440
     tgtcaactgt ctctggcaaa agaagatgtg cacaatttgc gcgaaggtgc gcgttatctg      1500
     acatcgaagg acgtgattag ttatctattg actcagcatg atgttcccac cgtctgggat      1560
     gagctggcac gcgataaatt attgccgctg gaatataaga aacagttatg gcaacgcaca      1620
     ttaaatttaa tgatgagcaa acggcaagaa gatcaagagc aagcctacga agtacagctg      1680
     gcgctgattg ataatggtgt tgttgacgaa gagatgttaa ataatgccat tgatttactg      1740
     gttgatttac ccgctgaata ccgctatcga atgcgtaacc aattatttga taataaagaa      1800
     ttaccttccg gaattatcaa caaactcgat caacagtatc gcttcaactc tgactgggcg      1860
     ctggctgttg tcagtatgaa aaatagcacc cgtagacaaa gtgaaagagg attacaccgc      1920
     tggaaccatg aggatagcga tatttttgcg gaactggcga cgataaaaga taaatcagat      1980
     gatgaatggt ggcgtgcatt gctgcaaagt cgcaatgatc atttgcgcca aacggcatta      2040
     cgcaacgcac ataccccggc gtcgttgtta acgacattga ctgagtctca ggatcggtcg      2100
     ctggctatta ataatccaca gctggctgcc gatgtgaaaa cggtgtggct aaaagaggat      2160
     ccatcattac ttttatttgt cgataaaccc gatctttcgc agttacggga tttagtgaaa      2220
     accggggcaa cgcggaaaat tcgcaatgaa gcgcgtcacc ggcttgagga aaaacaatga      2280
//

If you have problems or comments...

PBIL Back to PBIL home page