(data stored in ACNUC7421 zone)

EMBL: BA000007.YDCC

BA000007.YDCC        Location/Qualifiers
FT   CDS_pept        272653..273789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcC"
FT                   /locus_tag="ECs_0241"
FT                   /product="H repeat-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33664"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33664"
FT                   /db_xref="GOA:Q8X4R7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X4R7"
FT                   /protein_id="BAB33664.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDFGETHLDFLRQYGDFENAIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKD
FT                   VIAIDGKTLRHSYDKSRRRGAIHVISAFSTMHSLVIGQIKTDEKSNEITAPPELLNILD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAISEKSHGREEIRLHIVCEVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKEPKMTV
FT                   RYYISSADLTAGKFATAIRNHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVLAGSGLS"
     atggaactta aaaaattgat ggaacatatt tctattatcc ccgattacag acaagcctgg        60
     aaagtagaac ataaattgtc agatattcta ctgttgacta tttgtgccgt catttctggt       120
     gcagaaggtt gggaagatat agaggatttt ggtgaaacgc atctcgattt tttgaggcaa       180
     tatggtgatt ttgaaaatgc tattcctgtc cacgatacca ttgccagagt tgtatcctgt       240
     atcagtcctg caaaatttca tgagtgcttt attaactgga tgcgtgactg ccattcttca       300
     gatgataaag acgtcattgc aattgatgga aaaacgctcc ggcactctta tgacaagagt       360
     cgccgcaggg gagcgattca tgtcattagt gcgttctcaa caatgcacag tctggtcatc       420
     ggacagatca agacggatga gaaatctaat gagattacag ctccccctga acttcttaac       480
     atactggata ttaaaggaaa aatcatcaca actgatgcga tggggtgcca gaaagatatt       540
     gcagagaaga tacaaaaaca gggaggtgat tatttattcg cggtaaaagg aaaccagggg       600
     cggctaaata aagcctttga ggaaaaattt ccgctgaaag aattaaataa tccagagcat       660
     gacagttacg caattagtga aaagagtcac ggcagagaag aaatccgtct tcatattgtt       720
     tgcgaagtcc ctgatgaact tattgatttc acgtttgaat ggaaagggct gaagaaatta       780
     tgcgtggcag tctcctttcg gtccataata gcagaacaaa agaaagagcc aaaaatgacg       840
     gtcagatatt atatcagttc tgctgattta accgcaggga agttcgccac agcaatccga       900
     aaccactggc acgtggagaa taagctgcac tggcgtctgg acgtggtaat gaatgaagac       960
     gactgcaaaa taagaagagg aaatgcagca gaattatttt cagggatacg gcacattgct      1020
     attaatattt tgacgaatga taaggtattc aaggcagggt taagacgtaa gatgcgaaaa      1080
     gcagccatgg acagaaacta tctggcgtca gtccttgcgg ggagcgggct ttcgtaa         1137
//

If you have problems or comments...

PBIL Back to PBIL home page