(data stored in ACNUC7421 zone)

EMBL: BA000007.YFDK

BA000007.YFDK        Location/Qualifiers
FT   CDS_pept        complement(305988..306431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdK"
FT                   /locus_tag="ECs_0282"
FT                   /product="phage tail fiber assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33705"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33705"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFK4"
FT                   /protein_id="BAB33705.1"
FT                   /translation="MDEYVYSARHNAFFPVDMIDKYKSEGWDLSDAKEVNQNIISEFMA
FT                   EPPQGKIRIAGDDGLPAWADIPPPTHEELIEITESERQLLINQANEYMNSKQWPGKAAI
FT                   GRLKGDELTQYNLWLDYLDALELVDTSGAPDIEWPTPPAVQAR"
     atggacgaat atgtttatag cgcaaggcat aatgcttttt tccctgtgga tatgattgat        60
     aaatataaat cagagggatg ggatttatca gacgctaagg aagtaaatca aaatattatc       120
     agtgagttta tggctgaacc gccacaagga aaaatccgta ttgccggaga tgatgggctg       180
     cctgcgtggg cagatattcc tccacccacg catgaagagc ttattgaaat tactgaatca       240
     gaaagacagc tactaattaa ccaggccaac gaatacatga acagtaagca atggcccggt       300
     aaagcggcta ttggtcgtct gaaaggtgac gaactgacgc aatataattt gtggctggat       360
     tatctggacg cactggagct ggtcgatact tccggtgcgc cagatattga atggcctacg       420
     cctccggcag ttcaggccag atga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page