(data stored in ACNUC7421 zone)

EMBL: BA000007.YIBG

BA000007.YIBG        Location/Qualifiers
FT   CDS_pept        271362..271907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yibG"
FT                   /locus_tag="ECs_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33661"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33661"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7S7"
FT                   /protein_id="BAB33661.2"
FT                   /translation="MDNSKHSDEAEKLLAELSARKGEGEGEGEGEGEGEGEGEPKSTVS
FT                   VFYLQPEEVNTLSHQAKRGDGEAGFRLFLYYKLSNYDEEKSSQWLKIAANNGHATAQYR
FT                   LYVELQEQGETKEANEWLQKIKLAASNNDSSAIWFLVNCYKNQGNKKEALQWAYKLKAS
FT                   KQPLDADRLIEELTKEQK"
     atggataact caaaacattc tgatgaggcg gaaaaattat tggcggagct ttctgctaga        60
     aaaggtgaag gtgaaggtga aggtgaaggt gaaggtgaag gtgaaggtga aggtgaacca       120
     aaatcaacag taagcgtctt ttatttgcag ccagaagaag taaatacttt atcacaccag       180
     gcaaaacgag gcgatggcga ggcgggtttt aggttgttct tgtactacaa gttgtccaat       240
     tatgatgaag aaaaaagtag tcagtggtta aaaatagcgg ctaataatgg tcatgcgaca       300
     gctcagtatc ggttatatgt agagttacaa gaacaaggtg aaaccaagga agctaatgaa       360
     tggttacaaa aaattaaatt ggctgccagt aataatgaca gttcagcaat atggttcttg       420
     gtgaattgtt ataaaaacca gggaaataaa aaagaagcat tgcaatgggc atataaactc       480
     aaagcgagta aacagccgct tgatgcagat cgactaattg aagaattaac gaaagaacaa       540
     aagtag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page