(data stored in ACNUC7421 zone)

EMBL: BA000007.YKGE

BA000007.YKGE        Location/Qualifiers
FT   CDS_pept        364323..365042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgE"
FT                   /locus_tag="ECs_0344"
FT                   /product="cysteine-rich LutA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33767"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33767"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6E9"
FT                   /protein_id="BAB33767.1"
FT                   /translation="MNVNFFVTCIGDALKSRMARDSVLLLEKLGCRVNFPEKQGCCGQP
FT                   AINSGYIKEAIPGMKNLIAALEDNDDPIISPAGSCTYAVKSYPTYLADEPEWASRAEKV
FT                   AARMQDLTSFIVNKLGVVDVGASLQGRAVYHPSCSLARKLGVKDEPLTLLKNVRGLELL
FT                   TFAEQDTCCGFGGTFSVKMAEISGEMVKEKVAHLMEVRPEYLIGADVSCLLNISGRLQR
FT                   EGQKVKVMHIAEVLMSR"
     gtgaatgtca atttctttgt cacctgtatt ggtgacgccc tgaaatcaag aatggcacga        60
     gactccgtgc tgctactgga aaaactcggc tgtcgcgtaa atttcccgga gaaacaggga       120
     tgctgcggtc agcctgcgat caatagtggt tatatcaaag aagcgattcc agggatgaaa       180
     aatctgatcg ccgcactgga ggataacgac gatcccatta tttcaccggc tggctcttgc       240
     acctatgccg taaaaagtta cccgacgtat ctggcggatg aacctgaatg ggcatcacga       300
     gccgaaaagg ttgccgcgcg tatgcaggat ctcacctctt ttattgttaa taaattaggg       360
     gtagtcgatg taggtgccag tttgcaaggg agagcggtgt atcacccatc ttgtagcctg       420
     gcccgtaagc tgggggtgaa ggacgagcca cttacgctgc tgaaaaatgt gcgtggactg       480
     gagctgttga cctttgctga acaggatacc tgctgcggat ttggcggcac gttctcggtc       540
     aaaatggccg aaatatccgg cgagatggtg aaagaaaagg ttgcgcacct gatggaagtc       600
     cgccctgagt atttaattgg tgctgacgtg agttgcctgc tgaacatcag tgggcgatta       660
     caacgggaag ggcagaaagt caaagtgatg catattgctg aagtgttgat gagccgctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page