(data stored in ACNUC7421 zone)

EMBL: BA000007.YKGF

BA000007.YKGF        Location/Qualifiers
FT   CDS_pept        365053..366480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="ECs_0345"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33768"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33768"
FT                   /db_xref="GOA:Q8X6E7"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6E7"
FT                   /protein_id="BAB33768.1"
FT                   /translation="MSIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDEL
FT                   GLWEEWRDRAAQIRDHVLSNLDAYLYQLSEKVTQNGGHVYFAKTKEDATRYILQVAQRK
FT                   NARKVVKSKSMVTEEIGVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRH
FT                   QIRRVLHERLGYEGPETPEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPKTHIAVMGMERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAG
FT                   HVDGPEEFHLVIVDNGRSEVLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYKDFKDLPYACSLCTACDNVCPVRIPLSKLILRHRRVMAEKGITAKAE
FT                   QRAIKMFAYANSHPGLWKVGMMAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGE
FT                   SFRSWFKKHQAQEKKNG"
     atgtcgatca aaaccagtaa tacagatttt aagacacgca tccgtcagca aattgaagat        60
     ccgatcatgc gcaaagcggt ggcaaacgcg cagcagcgta ttggggcaaa tcggcaaaaa       120
     atggtcgatg aattggggct ctgggaggag tggcgcgatc gggccgccca gatacgtgat       180
     catgttctga gtaatctcga cgcttatctg taccagctct cagaaaaagt gacgcaaaac       240
     ggcggtcacg tctattttgc aaaaaccaaa gaagacgcta cccgctacat tttacaggtt       300
     gcccaacgca aaaatgcccg gaaggtggtg aaatctaaat cgatggtgac cgaagagatt       360
     ggtgtcaatc atgtgttgca ggatgctggc attcaggtga ttgaaaccga tttgggtgaa       420
     tatattctcc agctggatca agatccgccc tctcatgttg tggtcccggc aattcataaa       480
     gatcgccatc agatccgtcg agtgctacac gaacgtctgg gctatgaggg gccggaaacg       540
     cctgaagcga tgaccttatt catccggcaa aaaatccgcg aagatttcct cagtgctgaa       600
     ataggtatta cgggctgtaa tttcgcggtg gcagagacag gttcggtatg cctggtgacc       660
     aatgaaggta atgcgcgaat gtgtaccacg ctgcctaaaa cgcatattgc agtgatggga       720
     atggagcgta ttgcccccac gtttgccgag gtagatgtat tgatcaccat gctggcgcgc       780
     agtgccgttg gtgcacgttt gacgggatac aacacctggc tgacaggacc tcgcgaagcg       840
     gggcacgttg atggtcctga agagtttcat ctggttattg tcgataacgg gcgttctgag       900
     gtgctggcct ctgaatttcg ggatgtgctg cgctgtattc gctgcggggc ttgtatgaat       960
     acttgtccgg catatcgcca tattggcggt catggatatg gctctattta tccagggcca      1020
     attggtgcgg tgatttctcc gctacttggc ggctataaag attttaaaga tttaccctac      1080
     gcctgctctt tatgcacagc ttgtgacaac gtgtgtccgg tgcgtattcc gctgtcaaaa      1140
     ctgattttgc gtcatcgtcg ggtgatggct gaaaaaggga tcaccgcaaa agcagagcaa      1200
     cgggcgataa aaatgttcgc ttatgccaat agtcatccag gattgtggaa agtcgggatg      1260
     atggccggtg ctcatgcggc aagctggttt atcaatggcg gcaaaacacc actcaaattt      1320
     ggcgcgatta gcgactggat ggaagcacgc gatcttcctg aagctgacgg agagagtttc      1380
     cgtagttggt ttaagaaaca tcaggcgcag gagaaaaaga atggataa                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page