(data stored in ACNUC7421 zone)

EMBL: BA000007.YKGG

BA000007.YKGG        Location/Qualifiers
FT   CDS_pept        366473..367168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgG"
FT                   /locus_tag="ECs_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33769"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33769"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6E5"
FT                   /protein_id="BAB33769.2"
FT                   /translation="MDNRGEFLNNVAQALGRPLRLEPQAEDAPLNNYANERLTQLNQQQ
FT                   RCDAFIQFASDVMLTRCELTSEAKAAEAAIRLCKELGDQSVVISGDTRLEELGISERLQ
FT                   QECNAVVWDPAKGAKNISQAEQAKVGVVYAEYGLTESGGVVLFSAAERGRSLSLLPESS
FT                   LFILRKSTLLPRVAQLAERLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVK
FT                   AVYLIIEDC"
     atggataatc gaggcgaatt tttgaataac gttgctcagg cactgggtcg cccgctgcga        60
     cttgaaccgc aagcagaaga tgcgccgctt aataactatg ctaacgagcg gcttacccaa       120
     cttaaccaac agcagcgctg tgacgcgttt attcagtttg ccagcgatgt tatgttgacg       180
     cgctgtgagc tgaccagcga ggcgaaggcg gcagaagctg caatacgtct gtgtaaagag       240
     ctgggagatc agtcggtcgt gattagcggt gacacgaggc tggaggaatt agggattagc       300
     gaacgtttgc agcaggaatg caatgccgtt gtttgggatc cggcgaaagg tgccaagaat       360
     atctcgcagg cagagcaggc taaagtgggt gtcgtgtatg ctgaatatgg tttaaccgaa       420
     tcgggaggcg tggttctttt ttccgccgcc gagcgtgggc gttcattgag cctgctcccg       480
     gaatcatctc tttttatcct gcgtaaaagc actctcctgc cgcgtgtagc gcaactcgca       540
     gaaagattgc atcagaaagc gcaggccggt gaacgcatgc cgtcatgtat taacatcatc       600
     agtggtccca gctcaacggc ggacattgag cttatcaaag tcgtcggggt tcatggtccg       660
     gtgaaagcgg tgtatctgat tattgaggat tgctga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page