(data stored in ACNUC7421 zone)

EMBL: BA000007.YKGL

BA000007.YKGL        Location/Qualifiers
FT   CDS_pept        344522..344713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgL"
FT                   /locus_tag="ECs_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33749"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33749"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6H7"
FT                   /protein_id="BAB33749.1"
FT                   /translation="MQAASQREETEWRVQSKRGLMPAYRGEAGQQVNINIMEYSERNVR
FT                   QLTLNEQEDTSPGKLMLV"
     atgcaggctg cgtcgcaaag ggaggaaact gagtggcgtg ttcagtctaa aagagggttg        60
     atgccagcat acaggggcga agctggtcaa caagtcaaca ttaatataat ggaatattcg       120
     gagagaaacg tcaggcagtt gaccttaaat gaacaggaag atacatcccc aggaaaatta       180
     atgctggtgt aa                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page