(data stored in ACNUC7421 zone)

EMBL: BA000007.YKGM

BA000007.YKGM        Location/Qualifiers
FT   CDS_pept        complement(344923..345189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgM"
FT                   /locus_tag="ECs_0327"
FT                   /product="50S ribosomal protein L31 type B"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33750"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33750"
FT                   /db_xref="GOA:P0A7N3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7N3"
FT                   /protein_id="BAB33750.2"
FT                   /translation="MMKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPY
FT                   VTIDVSSKSHPFYTGKLRTVASEGNVARFTQRFGRFVSTKKGA"
     atgatgaagc ccaatatcca tcctgagtat cgtactgtgg tgttccacga caccagtgtt        60
     gatgagtact ttaaaatcgg ctcgactatc aaaacagacc gtgagattga gctggatggc       120
     gtaacgtatc cgtacgtaac aattgatgtc tcttcgaaat cgcacccgtt ctatacaggg       180
     aagctgagaa cagtggcatc agaaggaaat gttgcacgat tcacccaacg ttttggtcgt       240
     tttgttagca cgaaaaaggg ggcgtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page