(data stored in ACNUC7421 zone)

EMBL: BA000007.YKGO

BA000007.YKGO        Location/Qualifiers
FT   CDS_pept        complement(344783..344923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgO"
FT                   /locus_tag="ECs_5701"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="GOA:A0A2Z5XFS5"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2Z5XFS5"
FT                   /protein_id="BBE29395.1"
FT                   /translation="MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKK
FT                   R"
     atgaaagtcc ttaactctct gcgtaccgca aaagaacgcc atccagactg tcagattgtg        60
     aagcgaaaag gacggctata tgtgatttgt aaatctaatc cacgctttaa ggccgttcag       120
     ggtcgtaaga aaaaacgttg a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page