(data stored in ACNUC7421 zone)

EMBL: BA000007.YLAC

BA000007.YLAC        Location/Qualifiers
FT   CDS_pept        complement(544847..545317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="ECs_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33934"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33934"
FT                   /db_xref="GOA:P0AAS1"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAS1"
FT                   /protein_id="BAB33934.2"
FT                   /translation="MTEIQRLLTETIESLNTREKRDNKPRFSISFIRKHPGLFIGMYVA
FT                   FFATLAVMLQSETLSGSVWLLVVLFILLNGFFFFDVYPRYRYEDIDVLDFRVCYNGEWY
FT                   NTRFVPAALVEAILNSPRVADVHKEQLQKMIVRKGELSFYDIFTLARAESTS"
     atgaccgaaa tacaacgcct gctgaccgaa acgattgagt ctctgaatac ccgcgaaaaa        60
     cgcgacaaca aaccccgctt tagtatcagt tttatccgta aacatccggg gctgtttatc       120
     ggtatgtacg ttgctttttt tgccaccctg gcggtgatgt tgcagtccga aacgctttca       180
     ggctctgtct ggctactggt tgtattattt atcctgctta atggtttctt ctttttcgat       240
     gtctacccac gctaccgcta tgaagatatc gacgtgttgg atttccgcgt ttgctataac       300
     ggcgaatggt acaacacgcg ctttgtacct gccgcgctgg ttgaagccat cttgaactct       360
     ccgcgtgtcg cggatgttca taaggaacaa ctgcaaaaaa tgatcgtccg taaaggtgaa       420
     ttgtcttttt acgatatttt taccctcgct cgcgccgaat caacatctta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page