(data stored in ACNUC7421 zone)

EMBL: BA000007.YLBA

BA000007.YLBA        Location/Qualifiers
FT   CDS_pept        complement(635770..636555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbA"
FT                   /locus_tag="ECs_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34000"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34000"
FT                   /db_xref="GOA:Q8XCV9"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCV9"
FT                   /protein_id="BAB34000.1"
FT                   /translation="MGYLNNVTGYRDDLLANRAIVKHGNFALLTPDGLVKNIIPGFENC
FT                   DATILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVISGNITAKAEGKTFSLS
FT                   EGGYLYCPPGSLMTFVNAQAEDSQIFLYKRRYVPVEGYAPWLVSGNASELERIHYEGMD
FT                   DVILLDFLPKELGFDMNMHILSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPV
FT                   KKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVEI"
     atgggatatt taaataacgt caccggttac cgcgatgatt tactggctaa ccgtgcgatt        60
     gtgaaacacg gtaatttcgc actgttaaca ccagacggtc tggtaaaaaa tattattccg       120
     ggctttgaaa attgtgacgc gacaatcctc tccacgccaa agctgggtgc ctcttttgtt       180
     gattatctgg tcacactgca tcaaaacggc ggcaaccaac agggcttcgg tggcgaaggc       240
     attgaaacgt tcctgtatgt gatctctgga aatatcactg ccaaagccga aggcaaaaca       300
     ttttccttaa gcgaaggtgg ctatctttat tgcccgcctg gctccttaat gacgtttgtt       360
     aacgcccagg ccgaagacag ccaaatcttt ttatataagc gccgctatgt tccggtagaa       420
     ggctatgcac cgtggctggt ttctggcaat gccagcgaac tggaacgcat tcactatgaa       480
     ggtatggatg atgtgatcct gctggatttc ctgcccaaag agttaggttt tgatatgaac       540
     atgcatatcc tttcttttgc accaggtgcc agccacggtt atatcgaaac acatgttcag       600
     gaacacggtg cctatattct ttccggtcag ggggtttata acctcgacaa taactggatc       660
     ccggtgaaaa aaggcgatta catctttatg ggcgcttatt ctttacaggc tggttatggc       720
     gtagggcgtg gtgaagcgtt cagctatatt tactcgaaag attgtaaccg cgacgtagag       780
     atttaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page