(data stored in ACNUC7421 zone)

EMBL: BA000007.YLBE

BA000007.YLBE        Location/Qualifiers
FT   CDS_pept        640866..642125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbE"
FT                   /locus_tag="ECs_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34004"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34004"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCV6"
FT                   /protein_id="BAB34004.2"
FT                   /translation="MFTSVAQANAAVIEQIRRARPHWLDVQPASSLISELNEGKTLLHA
FT                   GPPMRWQEMTGPMKGACVGACLFEGWAKDEAQALAILEQGEVNFIPCHHVNAVGPMGGI
FT                   TSASMPMLVVENVTDGNRAYCNLNEGIGKVMRFGAYGEDVLTRHRWMRDVLMPVLSAAL
FT                   GRMERGIDLTAMMAQGITMGDEFHQRNIASSALLMRALAPQIARLDHDKQHIAEVMDFL
FT                   SVTDQFFLNLAMAYCKAAMDAGAMIRAGSIVTAMTRNGNMFGIRVSGLGERWFTAPVNT
FT                   PQGLFFTGFSQEQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGASGMEAARAVSEEM
FT                   AEIYLERNMQLQIPSWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVR
FT                   APLACFEQALEALAESMGIG"
     atgtttacat cagtggcgca agccaatgct gcggttatcg aacaaattcg tcgcgctcgt        60
     ccacactggc tggatgtgca accggcttct tcacttatca gcgaactaaa cgagggcaaa       120
     acactgcttc acgccgggcc gccaatgcgc tggcaggaga tgaccggacc catgaaaggg       180
     gcgtgcgtgg gcgcatgtct gttcgaaggt tgggcgaaag atgaagcgca ggcgctggca       240
     atactggagc agggggaagt gaacttcatt ccttgtcacc atgtgaatgc cgtcgggcca       300
     atgggcggta ttacttctgc cagtatgccg atgctggtgg tcgagaacgt gaccgacggc       360
     aaccgggcgt actgcaacct caacgaaggt atcggcaaag tgatgcgttt tggcgcttac       420
     ggcgaagatg tcctgactcg ccatcgctgg atgcgcgatg tgttaatgcc agtattaagc       480
     gcggcgctgg ggcgcatgga gcgcggtatc gatcttactg cgatgatggc gcagggcatt       540
     acgatgggcg atgagttcca tcaacgcaat attgcttcct cagcactgtt aatgcgtgcg       600
     ctggccccac aaattgctcg cctcgatcat gataaacagc acatcgcgga agtgatggat       660
     ttcctcagcg tgaccgatca gttcttcctc aacctcgcga tggcttactg caaggcggcg       720
     atggatgctg gcgcgatgat ccgcgcaggc agcatcgtca cggcaatgac ccgcaacggc       780
     aatatgttcg ggattcgggt aagcgggctg ggcgaacgct ggtttactgc gcctgtaaac       840
     actccgcaag gtctgttttt caccggcttc tcgcaggagc aggcgaaccc ggatatgggc       900
     gatagcgcga ttaccgaaac ctttggtatc ggaggtgcgg caatgatcgc agcgcctggc       960
     gtaacgcgct ttgtcggtgc gagtggcatg gaagcggcca gggcggtatc tgaagagatg      1020
     gcggaaattt accttgaacg caatatgcag ttgcagatcc caagctggga ttttcagggc      1080
     gcgtgcctgg gactggacat tcgtcgcgtg gtagaaaccg gcattacgcc actcatcaat      1140
     accggtatcg cccataaaga ggcggggatc gggcagattg gcgcaggcac cgtgcgggca      1200
     ccgctggcgt gctttgaaca ggcgctggaa gcactggctg aaagcatggg gattggttga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page