(data stored in ACNUC7421 zone)

EMBL: BA000007.YNCI

BA000007.YNCI        Location/Qualifiers
FT   CDS_pept        276198..277370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yncI"
FT                   /locus_tag="ECs_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33668"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33668"
FT                   /db_xref="GOA:Q8X7R5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7R5"
FT                   /protein_id="BAB33668.1"
FT                   /translation="MSIQSLLDYISVIPDIRQQGKVKHKLSDILFLTVCAVIAGADEWQ
FT                   EIEDFGHERLEWLKKYGDFDNGIPVDDTIARVVSNIDSLAFEKIFIEWMQECHEITDGE
FT                   IIAIDGKTIRGSFDKGKRKGAIHMVSAFSNENGVVLGQVKTEAKSNEITAIPELLNLLD
FT                   LKKNLITIDAMGCQKDIASKIKDKKADYLLAVKGNQGKLHHAFEEKFPVNVFSNYKGDS
FT                   FSTQEISHGRKETRLHIVSNVTPEFCDFEFEWKGLKKLCVALSFRQKKEDKSAEGVSIR
FT                   YYISSKDMDAKEFAHAIRAHWLIEHSLHWVLDVKMNEDASRIRRGNAAEIISGIKKMAL
FT                   NLLRDCKDIKGGVKRKRKKVALNTCYIEEVLASCSELGFRTDKMKNLTQI"
     gtgagtattc aaagtttgct tgattatatt tcagtgatcc ctgatatacg acaacaagga        60
     aaggttaaac ataaattatc tgatattttg tttctcaccg tatgtgcagt aattgcaggt       120
     gccgatgagt ggcaggaaat tgaagatttt ggacatgaaa gacttgaatg gctaaagaaa       180
     tatggtgatt ttgataatgg cattccggtc gatgacacca ttgcacgcgt tgtgagtaac       240
     attgacagtt tggcctttga aaagatattt attgaatgga tgcaggagtg ccatgaaatc       300
     actgatggtg aaattatagc aatagatgga aagaccataa gaggctcctt tgataaggga       360
     aaaagaaaag gagcaatcca tatggtgagt gcattctcga acgaaaatgg tgttgtactg       420
     gggcaggtaa aaacggaagc caaaagtaat gagattacag ccattccaga gttgcttaac       480
     ctactggatt taaagaaaaa tttgataacc attgatgcta tgggctgtca gaaagatatc       540
     gcttcgaaga tcaaagataa aaaagcagat tatcttctgg cagtaaaagg caatcagggg       600
     aaattacatc atgcattcga ggaaaaattt cctgtaaatg tgttttctaa ttataaaggc       660
     gattcgttta gtacgcagga gataagtcat ggaagaaaag aaacacgttt gcatattgtc       720
     agtaacgtaa cgcctgaatt ttgtgatttt gaattcgaat ggaagggatt aaaaaagctt       780
     tgtgtagcat tgtcattcag gcagaagaaa gaagataaat cagcagaagg tgtaagcatc       840
     cgatattata tttcatcaaa ggatatggat gctaaagaat ttgcacatgc tatcagagcg       900
     cactggctga tcgagcacag tcttcattgg gtgttagatg taaaaatgaa tgaagatgcc       960
     agccggataa gaagaggaaa cgcagccgaa ataatatctg gaataaagaa gatggcactg      1020
     aatttattaa gagattgcaa agacattaag ggtggggtga agaggaaaag aaagaaggtt      1080
     gcgttaaaca catgttatat agaagaagtg cttgcatcct gctcagagct tgggtttcga      1140
     actgacaaaa tgaaaaattt aacacagatt taa                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page