(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0025

BA000012.MLL0025     Location/Qualifiers
FT   CDS_pept        complement(20875..21372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0025"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47701"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47701"
FT                   /db_xref="GOA:Q98NR0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NR0"
FT                   /protein_id="BAB47701.1"
FT                   /translation="MPLLLKGSCRCNAVRFEVESHTPVPFMLCYCSICRKQQGGGGFAI
FT                   NLGAAYETLNIRGKRSLGVYRAEIEDDEHPHCEVSTGERNFCRKCGSALWLYDPTWPEL
FT                   VHPFASAIDSDLPKPPSRVHLMLKYKANWVEPVIGKGDKTFDVYPEESIADWHKLTGMW
FT                   VD"
     atgccgcttc tgctcaaggg gtcctgccgc tgcaacgccg tgcgtttcga ggtggagagc        60
     cacacgcccg taccgttcat gctgtgctac tgctcgatct gccgcaagca gcagggcggc       120
     ggcgggttcg ccatcaatct cggcgccgcc tatgagacgc tgaacatcag gggcaagagg       180
     agccttggcg tataccgtgc cgagatcgag gacgacgagc atccgcattg cgaggtctcg       240
     acgggcgagc gcaatttctg ccgcaaatgc gggtcggcgc tctggcttta cgacccgacc       300
     tggccggagt tggtgcaccc cttcgcctcg gcaatcgaca gcgacctgcc gaagccgccg       360
     agccgggtgc atctgatgct gaaatacaag gccaactggg tcgaacccgt gatcggcaag       420
     ggcgacaaga cgttcgacgt ctacccggag gaatccatcg ccgactggca caagctgacg       480
     ggcatgtggg tggactag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page