(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0029

BA000012.MLL0029     Location/Qualifiers
FT   CDS_pept        complement(22778..23722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0029"
FT                   /product="carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47704"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47704"
FT                   /db_xref="GOA:Q98NQ7"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NQ7"
FT                   /protein_id="BAB47704.1"
FT                   /translation="MVKSIEILAVGGAHIDRRGQVSGAYVPAASNPGTMREDVGGGVFN
FT                   ALRSTVRRGVSGSLMSMRGGDAGADTISRAIAQAGIADLSAVFLDRTTPSYTALIDREG
FT                   ELIVGFADMALYDLAFPKQMRRSKVREAIAAADAILCDANLPSAALERLVSLAAGKPVY
FT                   AIAISPAKVVRLIPVLGALALVFMNRREAVALAGVNANAAERDVIDGLRCSGLTSGVVT
FT                   AGSAPVLGFDEAGAFSIQPPAPRKVANVTGAGDALAGATVAALLHGLPLRQALREGIAA
FT                   ATLAIESADAIPDFTAASFAEVLALVPNAQEVA"
     atggtgaaat ccatagagat actggccgtg ggcggcgccc atatagaccg gcgtggccag        60
     gtgtccggcg cctacgtgcc ggccgcgtcc aatcccggca cgatgcgcga ggatgtcggc       120
     ggcggcgtgt tcaacgcgct gcgcagcacg gtgcggcgcg gcgtatcggg ctcgctgatg       180
     tcgatgcgcg gcggcgatgc cggggcggac accatttcga gggctatcgc gcaagccggc       240
     attgccgacc tgtcggcggt cttcctcgac cgcacgacgc cgagttatac ggcgctgatc       300
     gatcgcgagg gcgagctgat cgtcggcttc gccgacatgg cgctgtacga tctggcgttc       360
     cccaagcaga tgcggcgctc caaggtccgc gaggcgatcg ccgccgccga tgccatactg       420
     tgcgacgcca atctgccgtc ggcggcactg gagcggctgg tttcgcttgc cgccggcaag       480
     ccggtctatg ccattgccat ttcaccggcc aaggtggtgc ggctgatacc ggtgctcggc       540
     gcgctggcgc tggtcttcat gaaccgccgc gaggccgtcg cgctggccgg cgtcaacgcc       600
     aatgccgccg agcgagatgt catcgacggc ttgagatgca gcggcctcac cagcggcgtc       660
     gtgacggcag gcagcgcgcc ggtgctgggt ttcgacgaag cgggcgcttt ttcgatccaa       720
     ccacctgccc ccagaaaagt cgccaacgtc accggcgccg gcgacgcgct ggcgggtgcg       780
     acggtggcag ccctgctgca cggcctgccc ctgcgccagg ccttgcgcga aggcattgcg       840
     gcggcgacgc tggccatcga aagcgccgac gccatccccg atttcaccgc agcgagcttc       900
     gccgaagtgc tggctcttgt gccgaacgcg caggaagtgg catga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page