(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0076

BA000012.MLL0076     Location/Qualifiers
FT   CDS_pept        complement(53249..53797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0076"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47737"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47737"
FT                   /db_xref="GOA:Q98NM4"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NM4"
FT                   /protein_id="BAB47737.1"
FT                   /translation="MKVKDADILIVPGYTNSGPEHWQTRWQSKLSTARRVEQAEWSKPV
FT                   REDWTASVAKAVNEAERPVVIVAHSLGVAAAVQAIPQFVKPVAGAFFVAPPDVANPGIK
FT                   PKHLMTFGPYPREPLPFPSIVIASRNDPFCAFDVAEDIAGAWGSLFIDAGETGHLNQDS
FT                   GFGPWPEGSMTFAKFLTDL"
     atgaaagtca aagatgcaga tatcctgatc gttccgggct acaccaattc cggaccagag        60
     cattggcaaa cccgctggca atcgaaactg tcgacggcgc ggcgcgtcga gcaggctgaa       120
     tggtcgaagc cggtgcgcga ggactggacg gcgagcgtgg ccaaagcggt caacgaggcc       180
     gagaggccgg ttgtcatcgt cgcgcattct ctgggtgttg ccgccgccgt gcaggccatc       240
     ccgcaattcg tcaagccggt cgccggcgcc ttcttcgtgg cgccgcccga tgtcgccaac       300
     cccgggatca agccgaagca cctgatgacc ttcggcccgt acccgcgcga gccgctgcct       360
     tttccgtcga ttgtgatcgc cagccgcaac gacccgttct gtgccttcga tgttgccgag       420
     gacatagccg gcgcctgggg ctcgctgttc atcgatgccg gcgagaccgg ccatctcaac       480
     caggattctg gcttcggccc ctggcccgaa ggctcgatga ccttcgccaa gttcctgacg       540
     gatctgtga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page