(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0105

BA000012.MLL0105     Location/Qualifiers
FT   CDS_pept        complement(73615..74118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0105"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47760"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47760"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK1"
FT                   /protein_id="BAB47760.1"
FT                   /translation="MERVLVSACLLGSHVRYNGSYRLDGHPVLTRWQAEGRVVQICPEV
FT                   AAGFSTPRPAAEIHGTADAVLDGQGRVVEQTGSDVTALYLEAGQLALELARETGCRYAV
FT                   LTDGSPSCGSSFVFDGSFSGKRVAGRGTTAALLEANGIRVFSEDSIGDLDALLNRPGSV
FT                   ETTA"
     atggaaaggg ttctcgtctc cgcctgcctg ctcggcagcc atgtccgcta taacggctcc        60
     taccggctgg acggccatcc ggtactgaca cggtggcagg cggaaggacg ggttgtgcaa       120
     atctgtccag aggtcgccgc aggcttctcc acgccgcgtc ctgcagcgga aattcacggt       180
     acagccgacg ctgtgctcga cggccagggt cgagtggtcg agcagacggg aagcgatgtg       240
     actgcacttt atctcgaagc cgggcagctt gcactcgaac tcgcgcgcga aacgggatgc       300
     cgctatgcgg ttcttaccga cggcagtccg tcctgcggca gcagcttcgt cttcgacggc       360
     agtttttcag gcaagcgcgt agccggtcgc ggcacgaccg ccgctctatt ggaggccaat       420
     ggcattcgcg tcttttcgga agacagtatc ggcgaccttg atgctctcct gaataggccc       480
     ggttcagtgg agactacggc ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page