(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0106

BA000012.MLL0106     Location/Qualifiers
FT   CDS_pept        complement(74139..75068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0106"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47761"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47761"
FT                   /db_xref="GOA:Q98NK0"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK0"
FT                   /protein_id="BAB47761.1"
FT                   /translation="MAPRKVIITCAVTGSVHTPSMSPYLPVTPDQIASDAIAAAEAGAS
FT                   ILHLHARDPKDGRPTADPDVFMQFLPRIKQATDAVINITTGGSSLMTLDQRLAAPLRAE
FT                   PEMCSLNMGSMNFALFPMLDKPREWQHEWEPKLLEATRDTIFKNTFADMEGVLERLGKG
FT                   CGTRFEFECYDVGHLYSLAHFRDRGLVSGPLFIQFVLGILGGIGADPDNLVHMKRIADK
FT                   LFGDSYQFSVLAAGRQQMPLISIAAAMGGNVRVGLEDSLYDGRQLAKSNADQVRRIRGI
FT                   LDGLSLEVATPAEAREMLALKGGDRVAF"
     atggcgccgc gcaaagtcat catcacctgc gccgtcaccg gctcggtgca caccccatcg        60
     atgtcgccct acctgccggt gaccccggac cagatcgcgt cggatgcgat cgcagcggcc       120
     gaggcgggcg cctcgatcct gcatctgcat gcccgcgacc ccaaagacgg ccggccgacc       180
     gccgatcccg acgtgttcat gcagttcctg ccgcgcatca agcaggcgac cgatgcggtg       240
     atcaacatca ccaccggcgg ttcgtcgctg atgaccttgg accagcgact ggccgcccca       300
     ttgcgcgccg agcccgaaat gtgctcgctc aacatgggtt cgatgaattt cgcgctgttt       360
     ccgatgctcg acaagccacg ggagtggcag cacgaatggg agccgaagct cctcgaagcc       420
     acgcgcgaca ccattttcaa gaacaccttc gccgatatgg aaggcgtgct cgaaagactg       480
     ggcaagggtt gcggcacgcg cttcgaattc gaatgctacg atgtcggcca tctctattcg       540
     ctggcgcatt tccgcgaccg cggcctggtg tcggggccgc tgttcatcca gttcgtgctc       600
     ggcattctgg gcggcatcgg cgccgatccg gacaatctcg tccatatgaa gcgcatcgcc       660
     gacaaattgt tcggcgacag ctatcagttc tcggtgctgg ccgccggccg ccagcagatg       720
     ccgctgatct cgatcgccgc ggcaatgggc ggcaatgtcc gtgtcgggct tgaagacagt       780
     ctctacgacg gccgccagct tgcgaaatcc aatgccgacc aggtgcgccg catccgtggc       840
     attctcgacg gcctgtcgct ggaggttgcc acgccggccg aagcgcgtga gatgctggcg       900
     ctaaagggtg gcgaccgggt ggctttctag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page