(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0115

BA000012.MLL0115     Location/Qualifiers
FT   CDS_pept        complement(81044..81949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0115"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47769"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47769"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NJ2"
FT                   /protein_id="BAB47769.1"
FT                   /translation="MLTALSELQPLPEPHSPAIAIEDVSRDLSRIIERAEVNAWLDLYA
FT                   AAPADFAARQGLSIAGEGDLAWTTCTTIPFVHFNCVKNFGVDSPASESQLDALLAHYRA
FT                   AGISRPWFYVNPHAEPSRLRCWLEARGLQRQGGWERIYRDAEPLSSEPLFTVDGVSVER
FT                   VTKASASEWAGFIDKSYRLPTTPWLLALVDRQGWHHYMAKRDGAVAAVRSLFIGVDGAA
FT                   WSGIEAPVPGIMAPSFDLDAVLGEALVRDGIAAGAKLFVADIEAPHEERDGPAYRNYAR
FT                   LGFRIAYFRSHYSYLPPSSN"
     atgctgaccg ccctgtcaga attacagccc ttgcccgaac cgcactcgcc agccatcgcg        60
     atcgaggatg tctcgcgcga cctcagccgg attatcgagc gcgccgaggt gaacgcctgg       120
     ctcgacctct atgccgcagc accggccgat ttcgccgcaa ggcaaggcct ttcgatagcg       180
     ggagaaggcg acctcgcctg gaccacctgc acgacgatcc cgttcgtcca tttcaactgc       240
     gtgaagaatt tcggcgtcga cagcccggcc tcggaaagcc agctcgacgc gctgctggcg       300
     cactaccgtg ccgctggcat ttcgcggccc tggttctatg tcaatccaca cgccgaacca       360
     tcacgcctca gatgctggct cgaggcgcgc ggcctgcagc gccagggcgg ctgggagcgg       420
     atttaccgcg acgccgaacc gctgtcgtcc gagccgctct tcacggttga cggggtttca       480
     gtcgagcgcg tgacgaaggc atcggcaagc gaatgggccg gcttcatcga caaaagttac       540
     cggctgccca ccacaccttg gctgctggct ctggtcgacc gacagggctg gcatcactat       600
     atggccaagc gggatggcgc agtggccgcg gtgcgctcgc tgttcatcgg cgtggacggc       660
     gcggcctgga gcggcatcga agcgccggtg ccgggcatca tggcgccgag cttcgatctc       720
     gacgcggtgc ttggcgaagc gctggtgcgc gacgggattg cggccggcgc gaaactgttc       780
     gtcgccgaca tcgaggcgcc gcacgaggaa cgcgacggcc cggcctaccg caattacgca       840
     cgcctgggct tcaggattgc ctatttccgc agccattaca gctatttgcc gcctagctcc       900
     aactga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page