(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0142

BA000012.MLL0142     Location/Qualifiers
FT   CDS_pept        complement(100041..100874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0142"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47789"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47789"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NH2"
FT                   /protein_id="BAB47789.1"
FT                   /translation="MRFKTIVAILQNEQDAERVLDCAIPLANRFQGHLIGIHAEALPVP
FT                   YTSATGFPDTEFLQVSADMSRERADKLQAVFLRRIEDSGLSFEWRSLESFSGDSALTGI
FT                   SSVRAADLIIAAQRETGGDPSADVDTLVYDAGRPVLVVPSAGPLVTTFKRVLLAWNGSK
FT                   EAARAAFDALPFIIEAEKTDILVIDPPDTFDESPEAAGAEIASALSRHGANVSVSVQKS
FT                   GGTSVDDMIQNRVAETGADLLVLGAYSHSWLRQLLFGGVTRTVLRTAQVAAFLSR"
     atgcgcttca agaccatcgt tgccattctg cagaacgagc aggacgccga gcgcgtgctc        60
     gactgcgcca ttccgctcgc caaccgcttc cagggccatc tgatcggcat ccatgccgag       120
     gcgcttccgg tgccctacac gtcggcgacc ggctttcccg ataccgagtt cctgcaggtc       180
     tcggccgaca tgagccggga gcgggccgac aagctgcagg ccgtcttcct caggcgcatc       240
     gaggattccg gcctctcttt cgagtggcgc agcctggaga gcttctccgg cgacagcgcg       300
     ttgaccggca tttcaagcgt gcgcgccgcc gatcttatca ttgccgccca gcgcgaaacc       360
     ggcggcgatc cgagcgccga tgtcgacacg ctggtctatg acgccggccg gccggtgctg       420
     gtggtgccga gtgccggtcc gctggtcacc acgttcaaac gcgtgctgct cgcctggaac       480
     ggcagcaagg aggccgcccg cgccgccttc gacgccctgc ccttcatcat cgaggccgag       540
     aagaccgaca tattggtcat cgatccgccc gatacgttcg acgaaagccc ggaggccgcc       600
     ggcgccgaaa tcgcgtcggc gctgtcacgc cacggcgcca atgtcagcgt ctcggtgcag       660
     aaatcgggcg gcacctcggt cgacgacatg atccagaacc gggtcgccga gaccggcgcc       720
     gatctgctgg tgcttggcgc ctacagccac tcctggctgc gccagctgct gttcggcgga       780
     gtgacgcgca cggtgctgcg tacagcacag gtggcggcct tcctgtcgcg ataa             834
//

If you have problems or comments...

PBIL Back to PBIL home page