(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0147

BA000012.MLL0147     Location/Qualifiers
FT   CDS_pept        complement(103580..103858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0147"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47794"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47794"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG7"
FT                   /protein_id="BAB47794.1"
FT                   /translation="MMDNKPFETPVVVELGHVGKYRHIRSTQEAAECLMTVWPLNRGPR
FT                   HRDALDTCLKVLEGYRSTAEARRALIEAARESEVLVPDDKLSDDRLH"
     atgatggaca acaaaccttt tgaaacgccg gtcgtggtcg aactcggcca tgtcggcaaa        60
     tatcgccata tccgcagcac ccaggaagca gcggagtgtc tgatgacggt ctggccgctc       120
     aatcgcggcc cgcgtcatcg tgatgccctc gacacttgcc tcaaagtgct ggaaggttat       180
     cgttcgacag cggaggcgcg acgggcattg atcgaggccg ccagggaatc ggaagtgctg       240
     gtgcccgacg acaagctatc cgacgaccgg ctgcattga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page