(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0148

BA000012.MLL0148     Location/Qualifiers
FT   CDS_pept        complement(103963..104280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0148"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47795"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47795"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG6"
FT                   /protein_id="BAB47795.1"
FT                   /translation="MSFRAFLPAAMLVTVAGFWLGASTPGVAQYCEGTVHGLSGRYNLA
FT                   TGSGFLAVRTRPNSSSRMIGQLFNGDHVEIFDRRGNWYQVEIGGSTGWANARWLRNDCR
FT                   Y"
     atgtcattca gggcattctt gccggctgcg atgcttgtga ctgtcgccgg cttttggctc        60
     ggcgcatcga cgccgggcgt cgcgcaatat tgcgagggga cggtgcacgg cctgtccggc       120
     cgctacaatc tggcgaccgg tagtggcttt ctcgccgtgc ggacacggcc gaactcgtca       180
     tcgcggatga tcggccagct gttcaatggt gatcacgtcg agattttcga ccgccgcggc       240
     aactggtatc aggtcgaaat cggcggctcg accggctggg cgaatgcacg ctggctgcgc       300
     aacgactgcc gctactga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page