(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0177

BA000012.MLL0177     Location/Qualifiers
FT   CDS_pept        complement(122913..123227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0177"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47817"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47817"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE4"
FT                   /protein_id="BAB47817.1"
FT                   /translation="MAGRVRRGLPFDTSSAQIDVEDRHREIIVAVVLVLEDDAKEFVSD
FT                   IDFGRIFLARPCLDLKLGVLEDALEIGVQLSDFVRLRQSSPIIGLAGLKGASGTSTMAM
FT                   "
     atggcaggcc gcgtcaggcg cggcctgcca tttgatacga gctcagccca gatcgatgtc        60
     gaggatcgcc atcgagaaat tatagtcgcc gtcgtcctcg tccttgaaga cgatgccaag       120
     gaattcgtct ccgacataga cttcggccga atcttccttg cgcggccgtg ccttgacctc       180
     aagcttgggg ttctggaaga cgcgcttgaa ataggcgtcc agctttctga tttcgtccgg       240
     cttcgacagt cttctccgat catcgggctt gctggtttga agggcgcttc tggcacgtcg       300
     acaatggcga tgtaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page