(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0182

BA000012.MLL0182     Location/Qualifiers
FT   CDS_pept        complement(125017..125574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0182"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47821"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47821"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE0"
FT                   /protein_id="BAB47821.1"
FT                   /translation="MLEIPEDRCERHRLFKAIDDAFKAGDFDGLGKALGGSPGWFDERM
FT                   PFELGLGHPLEYAIYWSPVGFISTLLDAGSDPNYQDHGGFPAIIAALSTDRADRLEVVR
FT                   VLIEAGADPNMRGVNDWTPLHYSVGIRSAEAIHLLLAAGADPTLATRIDDYTTAFEEAD
FT                   KAGFEAGASLLRDAIARRGFNR"
     atgttggaga tcccggaaga tcgatgcgag cgtcatcgtc tgttcaaggc gatcgacgat        60
     gccttcaagg ccggtgactt cgatggcctt ggcaaagcgc tgggcggttc gcccggctgg       120
     ttcgacgagc gcatgccgtt cgaactcggc ctcggacatc cgctggagta cgcgatctat       180
     tggagcccgg tcggcttcat ctcgacgttg ctggatgcag gttcggatcc gaattatcag       240
     gatcacggcg ggtttccggc aatcattgcg gcgctgtcca ccgaccgggc cgacaggctg       300
     gaagtcgtgc gggtgttgat cgaggctggc gccgatccca atatgcgggg cgtgaacgac       360
     tggacgccgc ttcactattc ggtgggcatt cgtagcgccg aggcgatcca cctgcttttg       420
     gcggctggcg ccgacccgac tctcgcaacc cgcatcgatg actatacgac agccttcgag       480
     gaagccgaca aagccggctt tgaagccggt gcttcattgc tgcgtgatgc catagcaagg       540
     cgcggcttta atagataa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page