(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0186

BA000012.MLL0186     Location/Qualifiers
FT   CDS_pept        complement(127524..128195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0186"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47824"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47824"
FT                   /db_xref="InterPro:IPR009922"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ND7"
FT                   /protein_id="BAB47824.1"
FT                   /translation="MGHQTTECAEQHTMNQNGSITLFHYWNRLRDGRPAPKRSEVEPAD
FT                   IKSLLADTFILEKDTRGQPVFRLAGTRLCACYGRELKGFSFPSLWREKDQRLVSRLIHG
FT                   VFDQKSVVLINFEGFSRNGRSNKFELLALPLDGGVENPRCLGVISAAEKPFWLGADPIT
FT                   DAMIDSIRVIDPEKEMLNNRPAIDVPSLVPAELEAPDTISALGRARRIRHLVVFDGGRD
FT                   E"
     atgggacatc agacgacaga atgcgcggag cagcatacca tgaaccaaaa cggatcgatc        60
     acgctgttcc attattggaa tcgcctgcgt gacggacgcc ccgctccgaa gcgttcggaa       120
     gtcgagccgg ccgatatcaa gtcgcttttg gccgacacgt tcatcctgga aaaggacaca       180
     cgcggccaac ctgtcttccg cctggccggc accaggcttt gcgcctgtta tggccgcgaa       240
     ctcaagggat tctccttccc gtcgctgtgg cgcgagaagg atcagcgtct ggtctcacgg       300
     ctgattcacg gggttttcga ccagaaatcg gtggtgctga tcaatttcga gggcttcagc       360
     cgcaatggcc gctccaacaa gttcgaattg cttgccttgc cgcttgacgg cggcgtcgag       420
     aacccgcgtt gccttggcgt gatcagtgcc gctgagaagc cgttctggct gggcgccgac       480
     ccgatcacgg acgcaatgat cgattcgatt cgtgtcatcg acccggagaa agagatgctc       540
     aacaaccgtc cggcgatcga cgttccctcg cttgttccag ccgaactcga ggcgcccgat       600
     acgatctcgg cgcttggccg ggcgcgccgc atccgccatc tcgtcgtctt cgacggcggg       660
     cgcgacgaat ag                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page