(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0206

BA000012.MLL0206     Location/Qualifiers
FT   CDS_pept        complement(139002..139460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0206"
FT                   /product="biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47839"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47839"
FT                   /db_xref="GOA:Q98NC2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NC2"
FT                   /protein_id="BAB47839.1"
FT                   /translation="MSIKKTGVDQQLIRDLAGILNDTNLTEIEVELGDLKVRVSRQAPA
FT                   VHAIAASQPSYASAAAQPAVAAAPATVDVSKNAVASPMVGTAYLAPSPDAKPFIEVGQK
FT                   VKEGQTLLIIEAMKTMNQIPSPRAGTVTAILFEDATPVEYGMPLVVIE"
     atgtcgataa agaagaccgg tgttgaccag caactgatcc gcgatctggc gggcatactg        60
     aacgacacca acctgaccga gatcgaggtt gaactgggcg acctgaaggt gcgcgtgtcg       120
     cggcaggccc ctgccgtcca tgcgatcgcc gcatcccagc ccagctatgc gtcggcagca       180
     gcccagcctg cggtcgcggc cgctccggcc acggtcgacg tgtcgaagaa cgcggtagcc       240
     tcgccaatgg tcggcaccgc ctatctggcg ccgtcgcccg atgccaagcc gttcatcgag       300
     gtcggccaga aggtcaagga aggccagacg ctgctgatca tcgaggcaat gaagacgatg       360
     aatcagatcc cctcgccgcg cgccggcacc gtgacggcga tcctgttcga ggatgcgacg       420
     ccggtcgaat acggcatgcc gctcgtcgtg atcgagtag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page