(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0231

BA000012.MLL0231     Location/Qualifiers
FT   CDS_pept        complement(163117..163878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0231"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47860"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47860"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA1"
FT                   /protein_id="BAB47860.1"
FT                   /translation="MGSLAVIDAPGWYETIRMADGVTLIHEPWIKPFFRCNIWHVRGRD
FT                   RDLLFDTGLGHFSLRTHVPLVTERKLTCVASHTHFDHIGCHHEFPDRGVHPAEAKILAD
FT                   PRNEWTVADRYATDDMFDGLPQGWESSRYRILPAPADRLLDHGDVVDLGDRAFEVIHTP
FT                   GHSPGGIALYEKKTGILLSGDIIYDGPLIDDVYHSDIPDYMATLLAMRELDVSVVHGGH
FT                   FPSFGKVRYRQLIDEYLAQKRRAGCHLRQRP"
     atgggatctc ttgcggtcat cgacgcacca ggctggtacg agaccatccg tatggccgac        60
     ggcgtcacgc tgatccacga gccgtggatc aagccgttct tccgttgcaa catctggcat       120
     gtgcgcggcc gcgaccgcga ccttctgttc gacaccggcc tcggccattt cagcctgcgc       180
     acacatgtgc cgctggtcac ggaacgcaag ctgacctgcg tcgccagcca tacgcatttc       240
     gaccatattg gctgtcatca cgaatttccc gaccgcggcg tgcacccggc ggaagcaaaa       300
     atcctcgccg atccgcgcaa cgaatggacg gtggctgacc gctatgcgac cgacgatatg       360
     ttcgatggat tgccgcaagg ctgggagtcc tcccgctacc ggatcctgcc tgccccggcc       420
     gaccgcctgc tcgaccatgg tgacgtcgtc gatctcggcg accgcgcctt cgaggtcata       480
     cacacaccgg gccattcacc cggcggcatc gcgctctacg aaaagaagac cggcatactg       540
     ttgtccggcg atatcatcta tgacggcccg ctgatcgacg acgtctacca ttcggatatt       600
     ccagactaca tggcgacgct gctcgccatg cgcgagcttg acgtctctgt cgtgcatggt       660
     ggccatttcc cgagcttcgg taaggtgcgc tatcgccagc tgatcgacga gtatctggcg       720
     cagaaacgcc gggccggctg ccatctgcgg cagcggccct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page