(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0249

BA000012.MLL0249     Location/Qualifiers
FT   CDS_pept        complement(175973..176383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0249"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47875"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47875"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N86"
FT                   /protein_id="BAB47875.1"
FT                   /translation="MRKTVQLLLVASLSGCVAPRPDAGDQHVDPIPFSLALEEVVITGI
FT                   RQHLPDPASVRLGRTLAGERTLNGRKEIVVCGFVNGKDPSGGSGGEQAFIARIYPDSAT
FT                   SFDLVAMGSASETRRLVDSTCSAAGLPISDSA"
     atgaggaaaa cggttcagct tctgcttgtc gcttcgcttt ccggatgcgt ggcgcctcga        60
     cccgatgccg gcgaccagca cgtcgatccg attcccttct cgctcgcgct cgaggaggtc       120
     gtcatcaccg gtattcgtca gcatttgccg gatcctgctt cggtcaggct cggaaggacg       180
     cttgccggcg agcggacact gaacggccgc aaggagatcg tggtctgtgg attcgtcaac       240
     ggcaaggatc cgtcaggcgg ctcgggcggc gagcaagcct tcattgccag gatctacccg       300
     gattcggcaa ccagcttcga tctcgttgcc atgggcagcg cttcggaaac gaggcgtctc       360
     gtcgatagca cctgcagcgc agccgggttg ccgatttccg attccgcctg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page